PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s889281g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 554aa    MW: 59972.5 Da    PI: 7.8519
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s889281g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.6e-24192236145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  PDK_30s889281g001 192 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 236
                        79****************************************985 PP

2QLQ55.41.8e-19122158137
                QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        ++FT+ Q+++L++Q+l+yKy++an+P+P  Ll  i++
  PDK_30s889281g001 122 GPFTPLQWMELEQQALIYKYMNANAPIPTSLLISIRR 158
                        59******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.6E-11122158IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.91123158IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.2E-14123156IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663192236IPR014977WRC domain
PfamPF088796.4E-21193235IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MDGLVGASFL CGGVFFSPRA SSDPESNKQN GFLRSGLVKE GRPCGPEEHD WRCLKVARTE  60
APSLFPDAQQ MLSFSSSKPD AFLFSSEPLS SVPLASSYVG NAGLVSGSLD VKMHGVLAGV  120
KGPFTPLQWM ELEQQALIYK YMNANAPIPT SLLISIRRSL SSSRFTSFSA GSLGPNTFGW  180
GSFHLGFSGN ADPEPGRCRR TDGKKWRCSR DAVADQKYCE RHMNRGRHRS RKPVEGQTGR  240
AAKVMPINAT TPAAPAVSGS GSPNNFTMAQ QQKNNVKANI TYSSPTQFDR VLANNELNNS  300
HDLSMLNSVN SEPTETLFPI ADQHNPFAEL PSRANYGLIS DSPFKLPSNS YLGNDNLVSS  360
VEFNDQDSPA NTFRHFIDDW HKKHSDSSTI IRTESEMQSD KTQLSISIPV ASSDFSSSSS  420
SPTHEKHTPS SLKLSLDFDP DNTHVGVGGH PNDGNQRQAS WLPTSWGSSM GGPLGEALAN  480
TCLDHNKNFS SLKLVTNGWD SSPQLKSSQT GVLQKFSFGS LCSTTRSSPV AEKHNLQDRI  540
GSSNLVNPST ITSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798914.10.0PREDICTED: growth-regulating factor 6-like isoform X1
SwissprotQ6AWY31e-113GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLM0TMQ01e-158M0TMQ0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P04970_0011e-157(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-67growth-regulating factor 1